DPCstruct | MC2811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 127 ± 18 aa |
| Standard deviation of domain lengths | 17.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2J902 | 1-125 | MTGLSASQLHPASLYAGDTIEYYSRCFVAGDARGLRSSVVLGIKEDVAAEYPISVDTGEMIPRDMMMKLTVDRFGNRFKPQYAVWRK… |
| A0A6A3XE65 | 1-128 | MVGLDMSELSPEELHAGDKIVYYSWAFVTGDSRGYRESVVLRVDSSNTEGRPIQVDTGESVLLTMKLKRLIDNTSIHCTGEEAKWRH… |
| A0A662Y2E5 | 1-142 | None |
| A0A225WVK7 | 1-98 | None |
| A0A080YXK5 | 146-268 | None |
| W2H7S9 | 5-138 | None |
| A0A833S7Q1 | 1-136 | None |
| A0A397F8U3 | 16-142 | None |
| A0A6G0XT86 | 18-143 | None |
| W2LK96 | 14-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.