DPCstruct | MC28105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 281 ± 36 aa |
| Standard deviation of domain lengths | 36.25 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05235 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655USB7 | 3-252 | ALHEIRHAVSYLRQLLSVYGGIIPRRASAILRQELKWLEQELQWLKEFEYLESLQEDKGYALRKLDARKFLVTALKTLQESLPQRED… |
| A0A7S7SI55 | 1-246 | MTSSEHARETLRQSIGKLEEQIVVTLKDTSEDPVHDLRVSIRRVSQALRTFGPLLPGKSARSMRKALKPALDAAAIARDHDVCEALL… |
| A0A7X9DFH7 | 9-311 | None |
| A0A2W4YJP2 | 263-566 | None |
| H0UQA4 | 8-296 | None |
| A0A2E3UWJ6 | 25-339 | None |
| A0A3N5F6R3 | 216-584 | None |
| A0A2M8PP92 | 118-406 | None |
| A0A532DK94 | 7-266 | None |
| A0A4Y8PQC2 | 6-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.