DPCstruct | MC28104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 129 ± 23 aa |
| Standard deviation of domain lengths | 22.95 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S7NYB9 | 2-112 | GIFGYWIGQLGDHYERKTGMHLYSGTLNLELPESDSLPPNPLRPEAHEYGGRVSVNIVPCLILGRPAFLLLTDQNEIGTGHHPRNLI… |
| Q971U9 | 6-134 | LHIKGKVTAGLGEGRIFLSIPYYIESFKKYLGFEPYAGTLNIVIYDRISLENRLILDLAKGIIIPEHKEPNRVLGSVKAFPSSINSI… |
| A0A2D6TTT9 | 1-159 | None |
| A0A7C7SQ74 | 10-170 | None |
| A0A354TCM9 | 2-126 | None |
| A0A133U442 | 6-83 | None |
| A0A7J3I2C9 | 21-155 | None |
| A0A7C9L895 | 112-241 | None |
| A0A7M3YLA7 | 66-211 | None |
| A0A7C6ZIE0 | 47-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.