DPCstruct | MC28101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 59 ± 10 aa |
| Standard deviation of domain lengths | 10.00 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M6TZT6 | 113-159 | RTEATVYITRTGSKYHRAGCRYLRQSQIAISLSEAKKYYDPCSVCNP |
| A0A3C0CXL3 | 10-69 | ASLITCRPVATYAADVTVYITKTGRKYHADGCRSLLRSRIPISKTDAAKRGYTPCKNCKP |
| A0A6N2ZU88 | 264-309 | None |
| A0A1G5GCR6 | 18-80 | None |
| A0A517YE64 | 319-381 | None |
| A0A3D4BTK8 | 24-79 | None |
| A0A1Y4W0K8 | 90-146 | None |
| A0A369L7A5 | 136-186 | None |
| A0A3B9EZF4 | 2-78 | None |
| A0A6P1TTD6 | 77-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.