DPCstruct | MC2810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 190 ± 32 aa |
| Standard deviation of domain lengths | 32.23 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 54.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4DUL2 | 1-168 | MKGGKRQVGKRSSGDKFQLSPSLLEVFADRYRAARNAHKGVDYQRLSTTKIFKDFKGHAEELGAKEPELKVLLKKALAEQREIDAGK… |
| G5ADJ8 | 9-167 | HELEAACKALVKKQQRTKGPKRQNERRKKSEPTKLSDTQYKIYAHRYAAARRKRRPVDYAQMLDGNDFKSFKGDVDELEALEGEVVA… |
| A0A6A3QEY7 | 275-484 | None |
| A0A6A3SZ15 | 1-234 | None |
| A0A6A4B3D8 | 8-201 | None |
| A0A6A4AGF9 | 56-289 | None |
| A0A6A4G3L1 | 5-195 | None |
| A0A6A3I1M1 | 5-169 | None |
| A0A6A4BWW1 | 2-142 | None |
| A0A6A4BH70 | 5-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.