DPCstruct | MC281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 118 ± 11 aa |
| Standard deviation of domain lengths | 11.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19802 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J7JNV2 | 53-173 | NSSSLTIHDSPSAQLLVEAVREFLEKDVMPNTEGRISFHARVASNALRMVERELGIGHDVNEHARTHLATLLGFDAPLADLLQALAA… |
| A0A1G9LIL7 | 2-100 | AAVRDFLQTDVLPAVEGRVRFHTRVAVNVLGMVERELELGPAQAAEHAARLAELGVADDAELAAAIRAGRVPDDGPLLDLLEQAVRA… |
| A0A1G9VHG6 | 1-105 | None |
| A0A6I1QGQ1 | 1-136 | None |
| A0A7G5IEM8 | 1-102 | None |
| A0A4T0V595 | 2-112 | None |
| A0A370D5S4 | 6-107 | None |
| A0A7C1IYL4 | 1-145 | None |
| A0A423ERK8 | 1-123 | None |
| A0A848UI35 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.