DPCstruct | MC28098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 200 ± 25 aa |
| Standard deviation of domain lengths | 24.55 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13559 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257WFN4 | 297-491 | RFAPKPPSPPTSSGPDWNLDLGLGDLFSSIGQFLGTLFHLLAYAALAVVAVLIILLVARAITELLKSRGGPTMASAATAVPLSDDRS… |
| A0A2V9JVC7 | 130-332 | TARSKLEEILSRREFGGVHGPSGMERLRNRAAAWLLNFLESLFGRLNRHPRATRAVPWLFVIVPGVFFLAWLARLLLNRPKAAAPGE… |
| A0A3L7Q2X3 | 301-516 | None |
| A0A848WWJ5 | 384-604 | None |
| A0A2W1URT6 | 41-273 | None |
| F6IH89 | 2-134 | None |
| A0A7W8VE92 | 14-210 | None |
| A0A7K0ZXN4 | 370-579 | None |
| A0A5P8E5V5 | 4-217 | None |
| A0A7W9IEL0 | 13-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.