DPCstruct | MC28096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 125 ± 17 aa |
| Standard deviation of domain lengths | 16.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09365 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1UZH8 | 5-125 | YYLQLEPGNSFIGCGFFEPNPADLLRIRKEFEMDDSEIRDILHLPAFKKVYNGFDTTNQVKTAPKGFDKTHKAIDLIKNKNFFVAHY… |
| A0A2V9JI21 | 107-226 | AGFYFHVSPEEVLIAGGVYMPGPKEILAVRNYIANHYEKLRRILSQKEFKGLFGGLEGERLTRAPKGFPPDHPAIDLLRYKQFLAYV… |
| A0A367H8I7 | 87-195 | None |
| A0A0K6FUF9 | 773-921 | None |
| R8BWK6 | 757-899 | None |
| A0A7Y1TPL1 | 37-151 | None |
| A0A1Q5GT95 | 96-211 | None |
| A0A2N2G218 | 6-120 | None |
| A0A1Q6ZJ23 | 2-103 | None |
| A0A2S4VGS2 | 7-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.