DPCstruct | MC28091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Standard deviation of domain lengths | 12.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08897 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538L8N4 | 3-143 | EEDRRRWAVPAGQGRMGDIELSLLDPGEADDRHFLILAEHPELQQAVEDDQDEIILHGNLMNPRLHISMHEIVANQLWTDDPPEAWP… |
| A0A661V5E3 | 143-273 | TLTRQRMRLVWESAQLNLPLSDEDARLVEVMREHPEYSDLWGRLDELPDEEIERGGVNPILHVTIHSTIENQIADGDPKEVRRVVET… |
| A0A3M1VQ82 | 148-288 | None |
| A0A661ELR7 | 8-141 | None |
| A0A2N2PRT8 | 2-106 | None |
| A0A1S9D2R7 | 7-141 | None |
| A0A3D5DW29 | 77-213 | None |
| A0A543PDH5 | 382-512 | None |
| A0A7C1YD29 | 2-132 | None |
| A0A356EP66 | 12-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.