DPCstruct | MC28090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 3.94 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 42.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5QE04 | 1-66 | MILLQLSSAQGPDECCLAVKKALDCLTKEAAREKVSLTRLETEPGRLPDTLRSALVSLDGEKAMAF |
| A0A329BDF7 | 1-69 | MILLQLSAAQGPAECCLAVARALACLQHEAAQAGIRTEQLEREDGEQPGTLRSVLLSLDGDGEDTLASH |
| A0A376TKL2 | 104-162 | None |
| A0A6L7IJE9 | 4-62 | None |
| A0A069RAY6 | 1-62 | None |
| A0A3N1PJS9 | 377-435 | None |
| A0A5S3YCW4 | 1-68 | None |
| A0A285JBS9 | 3-62 | None |
| A0A2X3KEP6 | 194-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.