DPCstruct | MC2809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 231 ± 23 aa |
| Standard deviation of domain lengths | 22.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3W351 | 23-264 | RGLHRVVVFFVALWYVVISMKAFLASVTVLRGIELKDQGITVHESTLIVAYAGESAINESPLVQKVLGGSTDLRDDTVYLVTNSSCS… |
| A0A6A3JFB4 | 1-214 | MKAELIVGYCGGGLIRDSPIVQKVLAGDTTPTNKTLYLQSATSTSFEKCADVEMFDANIYGEANLYYGFLALIASSSYNLTWLQDME… |
| A0A6G0WR82 | 1-193 | None |
| A0A6G0WR94 | 1-243 | None |
| A0A067CPJ0 | 7-247 | None |
| A0A067CXB2 | 31-255 | None |
| A0A1V9ZVX8 | 7-254 | None |
| A0A1W0A4F9 | 5-188 | None |
| H3HDQ6 | 11-253 | None |
| A0A6G0QX18 | 1-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.