DPCstruct | MC28087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 101 ± 10 aa |
| Standard deviation of domain lengths | 9.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 59.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6WNS0 | 109-196 | MLGAVGAIAPEIFGKLGLIPPETALPWFQTGVIPPAGTYNYWADSYTLFVMEMAFMGFAEHRRAQDYYNPGSMGKQYFLGFEKYLGGT |
| A0A804L2H3 | 1-95 | MLGAAGEIAPETLGKLGMRPAETALPWFKTGAMPPAGTCVYWADPYTLFVLEMALMGFAEHRRFQDWAKPGTMGKQYFLGLEKGLGG… |
| A0A7J7QD07 | 332-451 | None |
| A0A2J8A2S2 | 358-466 | None |
| A0A2J7ZVV8 | 328-437 | None |
| A0A6P4MRP4 | 10-99 | None |
| A0A843US34 | 167-272 | None |
| A0A5D2WJ95 | 1-95 | None |
| A0A6L5B7P7 | 518-623 | None |
| A0A6A2ZVI9 | 1007-1112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.