DPCstruct | MC28085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Standard deviation of domain lengths | 8.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 67.80 |
| Pfam Score | 88.33 |
| Assigned Pfam label(s) | PF16916- PF01545 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D6M4K9 | 223-316 | VGVTIVKFILTVYCRRFKNEIVRAYAQDHFFDVITNSVGLAAAVLAVKFYWWIDPTGAIIIALYTINTWAKTVIENVGSLIGRTAPP… |
| A0A804KXE9 | 1-95 | MLSATFVKLALWLYCRTSGNKIVRAYAKDHYYDVVTNVLGLAAAILGDKFYRWIDPAGAIVLAIYTIINWSGTVWENAVSLVGQSAP… |
| A0A1J6JEH6 | 1-101 | None |
| A0A803LM24 | 1032-1125 | None |
| A0A834X028 | 198-291 | None |
| A0A0L9VIB2 | 1-94 | None |
| A0A4S4DF87 | 231-324 | None |
| A0A1R3JW12 | 947-1040 | None |
| A0A830CVF8 | 848-913 | None |
| A0A446QPK3 | 38-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.