DPCstruct | MC28083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 380 ± 52 aa |
| Standard deviation of domain lengths | 51.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.29 |
| Pfam Score | 76.19 |
| Assigned Pfam label(s) | PF00476- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6T6ALE6 | 5-298 | QSQVPMKDRFGTHKVKRDGTLRKEVEVPPTTAIHRSVEHIADWIRYACDDAEMTWYLRLALKERLSVIPAVDGLSMYHLYLKFFVSF… |
| A0A804KIY6 | 2-387 | MHLARLFDSSRRANGGYSLEALTNDPKIMSSDDELKMGKIAMKSIFGKRKLKKDGSEGKLITLAPVDVLQREERISWICYSALGSIS… |
| A0A7I4CPA7 | 679-1097 | None |
| A0A4S8IFU8 | 51-409 | None |
| A0A453RWI4 | 27-398 | None |
| A0A0W8BGU7 | 152-513 | None |
| A0A830HFH7 | 405-852 | None |
| A0A0E0I7R8 | 443-809 | None |
| A0A444DHK4 | 1-285 | None |
| A0A287JJN6 | 27-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.