DPCstruct | MC2808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 254 ± 57 aa |
| Standard deviation of domain lengths | 57.19 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 70.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0SE89 | 47-224 | MTKTNKAFAYITNTAREDRKVARVLSGWAADDVPAMVDVAALDHASRERLGHFQVFLFGSCTGLNQQRLNVSIKVLSVLTAYLVRYY… |
| A0A6A3VYA3 | 10-277 | SKQDHMIAKVLSGYKPKAAVPLQDLSSFDSQTLEAIDEVQRNLFAACYQLETEIYNVNKKVIDVLTACVVRHYPLLKSLSPQSPAVK… |
| A0A6G0XJC5 | 3-365 | None |
| A0A225WND7 | 7-252 | None |
| A0A225WJF7 | 234-506 | None |
| A0A6G0W903 | 1-150 | None |
| A0A6A3IZG1 | 2-214 | None |
| A0A6A3YW57 | 184-438 | None |
| A0A6A4C2P1 | 213-514 | None |
| G4ZDT1 | 10-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.