DPCstruct | MC28079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 293 ± 44 aa |
| Standard deviation of domain lengths | 43.74 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0D346 | 53-333 | LRGEDRKLFQTLVDYQKLEKSLTVKLSVKTGWRPSNTEAAVIHADICQRCNRRRSVTVMTSYRICRYCSAGRNPTDAPEDHDDSTPV… |
| A0A6A6RP30 | 2-298 | TYQHAGANLLTTLTAKVSWTPVKTQMPIGYVVNCSGCGFPRSVTIMTANSRCGLCKVTASEWNDVEHRKRAISANVTTEDTAASKAT… |
| A0A836BAJ2 | 539-834 | None |
| A0A162W7U7 | 243-537 | None |
| A0A0F0I4H4 | 1-240 | None |
| C9SYV8 | 359-678 | None |
| W9J933 | 1-255 | None |
| W4GX81 | 55-364 | None |
| A0A010S131 | 545-916 | None |
| A0A3N4LHN8 | 19-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.