DPCstruct | MC28075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 174 ± 30 aa |
| Standard deviation of domain lengths | 29.77 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D9WHI3 | 338-515 | TLRTKTSIHEALSRKIQPVLALNKIDRFFLEQHVDGIQVYPKEGTVVFLSCLHGWAFSLSSFAKIYSSKYNVEESKMIDCGNFFDPA… |
| A0A0K0F4D9 | 281-450 | FMNKMDRALLELQLGQEELFQTFQRIIENINVIIATYGDDDGPMGAIMVDPSVGNVGFGSGLHGWAFTLKQFAEIYAEKFGVQVEKL… |
| A0A443R2V6 | 475-678 | None |
| A0A835LAA3 | 89-286 | None |
| B9FKN5 | 582-715 | None |
| A0A7J7IIU7 | 273-509 | None |
| T1H201 | 1-157 | None |
| A0A7R9B945 | 2-116 | None |
| A0A1U7Y7E1 | 33-179 | None |
| A0A2V2WQD0 | 3-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.