DPCstruct | MC28073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 136 ± 14 aa |
| Standard deviation of domain lengths | 13.89 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3JCZ0 | 1-112 | MTFSNDVTIAGEFHDKDDASADIYRKIALYSQDDDRNVTAEYTITVPTLIVESENTNIVHGTIKGDVLVKANGFVLDGAKVEGNVTF… |
| A0A357M5V1 | 1-131 | MDNEEAFKKAISADGTWIAATLKDLSFTEDLVLDGQFTNKDKPARKIALYTQDAEHNITNSYKLTAPKLTIKSKNARIQGGTFIGDV… |
| A0A161UKS6 | 52-197 | None |
| A0A845LW39 | 70-239 | None |
| A0A7C7ED71 | 25-155 | None |
| A0A1M6H1V3 | 479-609 | None |
| L0K8F5 | 194-326 | None |
| A0A6I6F6T7 | 559-692 | None |
| A0A841L2I6 | 486-621 | None |
| A0A841KVG2 | 331-469 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.