DPCstruct | MC28070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 5.07 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 54.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10234 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814S4I4 | 1-88 | MTYRDISHLCEMTRVLSYPRLISMENFRQPNFRLVAELMAWLVKQYDPLSEVPTEIEREQDRVLFIRTVAQIIATKAHVKLNTKKLYQ |
| A0A1A8PR83 | 1-88 | MSFRDLRNFTEMMRALGYHRLISMENFRTPNFALVSEILIWLVKRYDPHSDIPTDVDTESDRIFFIKAVAQFMATKAHIKLNTKRLYQ |
| A0A1I7UH02 | 1-78 | None |
| A0A1I7YFV1 | 55-145 | None |
| A0A6A4VVY8 | 1-81 | None |
| A0A0R3T1A5 | 1-90 | None |
| A0A1Y2HG48 | 1-87 | None |
| A0A2T7PZL0 | 1-87 | None |
| A0A0B1S4Y5 | 1-92 | None |
| A0A0L0S545 | 84-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.