DPCstruct | MC2807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 80 ± 4 aa |
| Standard deviation of domain lengths | 3.96 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 43.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3VR75 | 7-86 | KLMKPIRFSYIGSGYQTEEKTKEIMLKWAMAKSQFADVKQTLGLTGLSGQQLTEHVNYEALQLFKGYVEEVKRLEETVAA |
| D0N607 | 115-191 | KSKKAKAYAKYGTGYQTEAKTKENLLQWVMRGDSPKEVSSTLGLLGLSRRKIIDHQNYEAFRTFLKYRKQWAEMQGN |
| A0A329RWG5 | 10-85 | None |
| A0A329RVZ0 | 4-84 | None |
| A0A6A3RKN9 | 49-131 | None |
| A0A6A3NPZ7 | 142-221 | None |
| A0A6A3NDN6 | 142-227 | None |
| A0A6G0QLU9 | 63-138 | None |
| B1NNT7 | 201-286 | None |
| W2JYX2 | 4-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.