DPCstruct | MC28068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 105 ± 7 aa |
| Standard deviation of domain lengths | 7.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2P853 | 98-204 | SPSGTRLGRSQALTTYFLFLELRHKVEIHRITGRVIECPIDEMNRPRGSKDVALRIPPSGPDVKTLFAVWGGELATCRQFAPTARNY… |
| A0A842K948 | 1-120 | MGKRGRATVRRKMTLIDHYFAFLEQRYAGEIARRFGVAFESPIDPFNRPRHRGDYGLRILPSHRAMREFFGRWRESLNEARKPVIAR… |
| A0A1D2IEE2 | 62-174 | None |
| A0A1I2XRX7 | 76-185 | None |
| A0A6H1LQ13 | 2-96 | None |
| A0A076MMD5 | 1-101 | None |
| A0A6G5R6D1 | 98-200 | None |
| A0A7J0CHL5 | 15-115 | None |
| A0A7W7S2S2 | 2-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.