DPCstruct | MC28067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 188 ± 10 aa |
| Standard deviation of domain lengths | 9.66 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7NF77 | 78-260 | SESILLISPEKEYDSIREESLKLMEFQHKTLTIQLTIVGVFFGFGFGKDAILFLVVPPFVLLLSIIYQNYKYKRFRIAAFIRNKYEF… |
| A0A0S8CJ15 | 25-213 | SNREIVQCWLAEFEGLRNLVLNFQRMQHNLIWVNISIMGAFLAIYFSYWQDKPDMTLFLAIPIVSSLLGVYWVAQGRQTSQIGYYIK… |
| A0A535R416 | 17-216 | None |
| A0A1V5AXS9 | 38-233 | None |
| A0A1G8M825 | 1-190 | None |
| A0A554LW77 | 4-171 | None |
| A0A352Y4M3 | 47-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.