DPCstruct | MC28061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 9.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17240 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E5XPL2 | 2-110 | TKPARTKPNFFQWMAYAHGRKLPDSMQEWVKNDLTGDWAGPRHLWRSMVPFLPIFALILVLVPGQLWLRGAMVLLMVILALIFSGAY… |
| A0A2U1FF27 | 1-97 | MIRPGVLRWIAYAFGARLPVRYAPWVLHDLTTRTWFLRHLARSAVQATPAALLALLPGPAWLRVALPLFVLVSTLFMATLFSPMVRE… |
| A0A1S1QJB3 | 27-141 | None |
| I8QVB7 | 26-126 | None |
| A0A178X5U9 | 109-218 | None |
| A0A4Q7KFT8 | 1-106 | None |
| A0A4R2JS93 | 2-112 | None |
| A0A511D7U0 | 82-212 | None |
| A0A358STS0 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.