DPCstruct | MC28060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 165 ± 12 aa |
| Standard deviation of domain lengths | 11.82 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U6EBK0 | 60-213 | PRPVYITSDNIINPTTDINRINAIVKALTDLGVTAVNWGLGPNTHVAVLQDSKVPKNALVVNIYGGACAGTIYEMGLNYYKNWAGSR… |
| A0A7J4TKY2 | 2-151 | ILRNAGADAYGYGIGPDTQNAVLRNSSVQQGALVVDIYGGACAGTIYAMIGSYYQGIKGAREVYSIWISPPAWNITDLPTKATNCGV… |
| K2QAW8 | 301-486 | None |
| A0A843F4D1 | 2-163 | None |
| A0A328SLN0 | 2-156 | None |
| A0A2A2H3J4 | 236-397 | None |
| A0A1V4Z0F8 | 4-154 | None |
| A0A328RZ64 | 19-187 | None |
| A0A843DN05 | 532-693 | None |
| A0A1V4YM07 | 172-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.