DPCstruct | MC28059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 308 ± 80 aa |
| Standard deviation of domain lengths | 79.73 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 85.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.16 |
| Pfam Score | 85.52 |
| Assigned Pfam label(s) | PF14960- PF02807- CL0286- CL0671- CL0068 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4YVF8 | 22-319 | NNHMARCLTKEIYAKLRDKVTPSGYTLDKVIQTGVDNPGHPFIMTVGCVAGDEESYDVFAELLDPVIDDRHGGYAKDAVHKTDLNFE… |
| A0A811Z5C2 | 6-261 | AAGDEESYDVCKELFDPILEDRPGGDEHKTGLNPDNLSRVRTGRSIRGFCLPPHCGRGERRALGKLAVEAPSSLAGDPAEQQQLIDD… |
| T1GFR8 | 1-238 | None |
| A0A671U9K2 | 2-170 | None |
| A0A0G4HNI4 | 2-267 | None |
| A0A086KW13 | 383-789 | None |
| A0A1Q9C880 | 14-262 | None |
| A0A2G8LKB0 | 48-416 | None |
| A0A6P8HWY1 | 2-309 | None |
| A0A7S4PGS4 | 52-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.