DPCstruct | MC28048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 139 |
|---|---|
| Mean domain length (aa) | 363 ± 103 aa |
| Standard deviation of domain lengths | 103.02 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 89.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.99 |
| Pfam Score | 97.02 |
| Assigned Pfam label(s) | CL0159- CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V6P1V4 | 2-334 | KIGVKKTVINPEFPVDLAGFGVPGRKSAGVHDYIYLSVMVAEHDGKKAAFICADIIGFDQKLVKDLKSSIYRRFGFHEDEVFFNASH… |
| A0A6A5E465 | 67-330 | PYLIGVGRADCTGPPAEIPLMGYASPEQTAAGIHTRLYSRAFIIDDGRRRVVFVTADVGMISQRLRLEVLQALKVKYGDLYRQDNVV… |
| A0A3A5H844 | 420-890 | None |
| A0A482VGV6 | 16-367 | None |
| A0A1V9YXH7 | 335-782 | None |
| A0A416IYV6 | 2-233 | None |
| A0A2X3XY87 | 116-486 | None |
| A0A183MMU7 | 320-718 | None |
| A0A5J4Z8W8 | 85-519 | None |
| A0A1F9VEL2 | 51-505 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.