DPCstruct | MC28042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 222 ± 38 aa |
| Standard deviation of domain lengths | 38.34 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0NAC8 | 1-239 | GGKYTDDTANYRVWHNTDATIGQPGKYLIDTQGKPVYFVDPTINGVLTKDDEGNDLERFEAPKATLMSYIIKGILNQELPWGLVLIG… |
| J9F6A4 | 99-244 | APQARAMAAVIEPLMSGQGAPWLLYGIGALISIVLTFFGVSALAFALGMFIPLQLNLPLIVGGFVNWYINSRSTDVELNRRRNEKGT… |
| A0A7W1KYR2 | 399-635 | None |
| A0A7W0YPT6 | 1-261 | None |
| A0A7V9FE51 | 252-511 | None |
| A0A7V8NS64 | 110-355 | None |
| A0A2V8SZN6 | 150-376 | None |
| A0A7V2AVJ4 | 9-227 | None |
| A0A7W1MVT0 | 1-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.