DPCstruct | MC28040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Standard deviation of domain lengths | 5.82 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08502 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0LC41 | 1-85 | LKDRRTYEIMRPEEVGVPAATLVLGKHSGRHAVQRRCEQIGVMVERRELDDLYRAVMAYAVRQKVVTDADLSAIVSRLRGTTPHV |
| A0A3N7JBM5 | 30-102 | KNRKNYEIIDPAMIGLELPDLILTSRSGRAALKNRLAALNISFAEKDFEQYYERFLKIADTKSIIDEKDLVHL |
| A0A5S9MEV8 | 4-88 | None |
| X1RBP2 | 1-68 | None |
| A0A396GX94 | 1-80 | None |
| A0A378MXJ3 | 2-83 | None |
| A0A835E6X4 | 375-448 | None |
| A0A446X7B0 | 230-304 | None |
| A0A1R3IXC0 | 877-950 | None |
| A0A3L6SWM4 | 712-791 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.