DPCstruct | MC28037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 127 ± 27 aa |
| Standard deviation of domain lengths | 27.17 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 66.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 38.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A699TPG9 | 36-175 | WTRHLVIRQRVEDFQLGIESYQIQLNLTKPRWDATGFEYKHDFTVIDSPRAVTFRYKYGVQMIMRFNEIHKFSDGTLHQIDEALDYR… |
| A0A6L2LJ52 | 1-87 | MFSIIYEPVYGIIYKNSKKEKRVMRHSEIHKFCDATLNKVLEGLKSYNNDVKYGYIQRDLTKDEVEYLKLFEEGIEDRLKYRRQMKR |
| A0A6L2NTJ0 | 94-266 | None |
| A0A699S3R3 | 9-120 | None |
| A0A6L2NHZ9 | 119-233 | None |
| A0A6L2NPV9 | 98-230 | None |
| A0A6L2NQM8 | 126-259 | None |
| A0A6L2NRU6 | 12-135 | None |
| A0A6L2NUL9 | 260-447 | None |
| A0A6L2JBK2 | 8-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.