DPCstruct | MC28036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 88 ± 13 aa |
| Standard deviation of domain lengths | 12.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 15.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9TQW8 | 1-71 | MNLQNLATHAHAGRIDALELISLEGGIYLLDIYLQGQRHSLIDARGDVWHLRSVEHARDLLRELPELPFHL |
| A0A4Y7XCU8 | 2-87 | NTIQESTLVDNARANAVKQIKIAPTPEGKGFHIYVTLSWKDEELLLVNTKKQPRVWSSLDRLYSHIETKYNAVKYLTVFFKDTDVN |
| A0A2Z2NPC4 | 2-89 | None |
| A0A6S5WT01 | 13-89 | None |
| A0A7Z1IKR4 | 9-95 | None |
| A0A0G8N7H9 | 1-82 | None |
| G4U4T2 | 59-136 | None |
| A0A172YHI1 | 1-78 | None |
| A0A369WT68 | 13-73 | None |
| A0A7D5UKG9 | 2-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.