DPCstruct | MC28033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 140 |
|---|---|
| Mean domain length (aa) | 92 ± 16 aa |
| Standard deviation of domain lengths | 15.94 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.46 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | PF00317- CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G3ACS7 | 1-58 | MQAAFQNHCDAAVSKTINFREKATASAVDRAYRLAYQLGCKGVTVYRRRSRKLEPMAL |
| A0A831V815 | 9-99 | EQVPKKIKNLFITALEIAPERHLQIQKAFQQFVDNSVSKTINLPHDATIKDVADSYLQAWRMGLKGITIYRYGSKSVQVLNIGADEK… |
| A0A3Q0JD53 | 433-573 | None |
| A0A7S4PFU3 | 20-162 | None |
| A0A662QH30 | 560-650 | None |
| A0A554J0F9 | 91-195 | None |
| A0A0G1HTF2 | 195-317 | None |
| A0A7C0U0Y7 | 3-71 | None |
| A0A1V6B3Z0 | 416-495 | None |
| A0A1F3ULT1 | 1-50 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.