DPCstruct | MC28030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 319 |
|---|---|
| Mean domain length (aa) | 165 ± 30 aa |
| Standard deviation of domain lengths | 29.86 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.16 |
| Pfam Score | 95.05 |
| Assigned Pfam label(s) | CL0270- CL0063- CL0250- CL0497- CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5LX96 | 29-205 | QPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTE… |
| A0A831KGJ6 | 35-181 | AFLRFAGMPVREALDRDCFDELMVTAVEPHLGRDKPVFLYDYPAERAALARRKKENDAVAERFELYIAGIELANGFSELVNPAEQRQ… |
| A0A6A7G2S6 | 399-550 | None |
| A0A3N4JGK3 | 698-882 | None |
| A0A0K9QRP3 | 275-461 | None |
| A0A832ZXA5 | 755-920 | None |
| A0A1S8VQ23 | 187-370 | None |
| A0A401FLA7 | 24-176 | None |
| A0A438NGR4 | 773-963 | None |
| A0A2J8AHF1 | 104-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.