DPCstruct | MC2803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 206 ± 39 aa |
| Standard deviation of domain lengths | 38.94 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 45.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14637 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397TQ92 | 387-547 | AVMRFKTSLCQLYSTPRIQPLWLNMSTFPQQRSKLAKSLLNELTFLLENFDNKKSNFFISTLISSVLMYHLAWVPTVAPISGFEERN… |
| A0A0C2HE44 | 1-196 | MRPVAWQDFCGSICQLHNAPRLRHPVWLSLLERDHNENVVVADFCRQLTRLVEKLDTKHTKFFLSNVISTVLMHHMSWVASVAPPLH… |
| A0A1I7XRV2 | 267-531 | None |
| A0A183UG71 | 328-538 | None |
| A0A0B2VTY7 | 404-635 | None |
| A0A1I9G4Z5 | 49-247 | None |
| A0A1Y1YYU3 | 275-507 | None |
| A0A3P7FYW4 | 1-235 | None |
| A0A016V5R7 | 384-543 | None |
| A0A368H9T2 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.