DPCstruct | MC28029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 223 ± 14 aa |
| Standard deviation of domain lengths | 14.14 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7F1J7 | 11-218 | LAEIDSCINRNRGTHFEAEIFSHLSCCPFVLRSYEFAIADGALYATLNSEPPTGSYTERFWQLNEQVRMLRNTSEHWKRILVPFDIK… |
| M2TCJ5 | 251-491 | LADVDSCIKRNRGTHFEAEIFSHLSCCPFVLRSYEFAIADGALYATPNSEPPTGSYTERFWQLDEQVRMFRNTSKHWSRVLVPFDIK… |
| A0A2V1EAB5 | 19-249 | None |
| W6YZ49 | 23-243 | None |
| A0A4S8X2Y6 | 2-241 | None |
| W6ZCB0 | 31-253 | None |
| F9XS84 | 1-194 | None |
| A0A4S8V4W7 | 12-230 | None |
| A0A4Q4S491 | 27-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.