DPCstruct | MC28028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 251 ± 50 aa |
| Standard deviation of domain lengths | 49.69 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0QEM3 | 1-247 | MDYWAEALQDDSYVIAATGWVAGSQPREIVKRKGKSGKLEWPEPGDYMLGRRRFTSDLIPARLMVARYFAAEQAEIDAFDVRIAELE… |
| A0A080KI44 | 80-343 | LAEIKTLLTNFNHIDIYDGYQIIAEIWQNSLLHDSEIIALSDFYTAGRSRVPNMVTKGTGDKKHEVQDGFIGSIVPNELIATELYTE… |
| A0A645HF28 | 2-187 | None |
| A0A173UKU4 | 4-408 | None |
| A0A5J4PT96 | 29-258 | None |
| A0A1V5QKN7 | 46-318 | None |
| A0A7V7B1X8 | 156-420 | None |
| A0A100IFU3 | 1-202 | None |
| A0A7V9KP01 | 245-487 | None |
| A0A425APS3 | 43-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.