DPCstruct | MC28022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 178 ± 37 aa |
| Standard deviation of domain lengths | 37.08 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822YAZ4 | 3-140 | SPVTIEELRSFHSIDRELYSRLVIKLRRDISTSMQVIALWMWLEDVGYPNIIHKMLSLPDSLVKALADEALICLNCITSDSSPPPPT… |
| A0A822ZR35 | 34-207 | LASLLAFHKVEREVFRRLIDMGLNPQVARNIICLWLWLEEIGFYDMVRQISIQSNEFLALVAAEAEAAFTFIEPDGMAPTAYVRLPL… |
| A0A7N2KPW2 | 6-132 | None |
| A0A444Y964 | 8-140 | None |
| A0A835AJK8 | 3-249 | None |
| A0A4S4D4U6 | 14-183 | None |
| U5CYA6 | 1-147 | None |
| U5DAI4 | 13-144 | None |
| A0A6A6LCB6 | 2-194 | None |
| A0A1R3HLP3 | 118-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.