DPCstruct | MC28019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 124 ± 32 aa |
| Standard deviation of domain lengths | 32.15 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 71.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 31.72 |
| Pfam Score | 98.21 |
| Assigned Pfam label(s) | PF05910- PF01699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822ZGJ0 | 24-105 | CKNLSLNGLCISVQGPEGDNQCNCKAELKPWYFWRKQGSKRFIEEDKAVDVFWDLKAASLNGETEPHSDYYVAVISEDEVVL |
| A0A5D2C075 | 3-125 | SPTLLVPSLQNQVSAIYKVILSTKKPLLVRVTWCKNQTGQGLILNFGDDDEDDPSTCFKLNTNLRFFRKKKGNKVIEANHSKIEVFW… |
| A0A843XC87 | 1-134 | None |
| A0A7I8I860 | 2-83 | None |
| A0A6A6N8L5 | 2-153 | None |
| A0A835N2T5 | 8-157 | None |
| A0A4S4CZH3 | 623-750 | None |
| U5DBW6 | 1-132 | None |
| A9P7T8 | 1-207 | None |
| A0A067JJI9 | 480-564 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.