DPCstruct | MC2801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 214 ± 24 aa |
| Standard deviation of domain lengths | 24.18 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182EIZ3 | 3-199 | INRKLFVLQGLHDYEEFVQLRTLCCICRLCEQDLLEKPAIYELLNDIIPFLAHPNEYLRMATLNILSTLDAKFNVADILCKVMPVVE… |
| A0A0C2H494 | 1-213 | MITFLNVKSDWRLRATFFESLPICVQKNSFDVKPLLQQGLHDFEEIVVIYAIHCTITLVETGVLERNEILELLEDALPFLSHPNEWI… |
| A0A150ASN6 | 608-843 | None |
| Q23669 | 609-839 | None |
| A0A813TWX0 | 732-939 | None |
| A0A5N6K6L6 | 13-253 | None |
| A0A6H5I1I1 | 622-844 | None |
| A0A553PIG1 | 105-291 | None |
| A0A6G0IDC7 | 393-575 | None |
| A0A0A9MS65 | 476-626 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.