DPCstruct | MC28009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 118 ± 12 aa |
| Standard deviation of domain lengths | 11.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A345R6R5 | 147-267 | EFNPTIPNCVSYVQPADFSIRHGNSARALCDLAGQKGYDLVAATDVNLIFVESALSDAVIGNDKPTLEQLRSEDKHVSYVFAGYNGE… |
| A0A838HDP9 | 1-131 | MEFNPTASNELYFVQDPDPALNQGSSLLAFVDLAKSKGYELVATTTTNAFFVVAEEYVQFRIDDNSIDAMHEVYMDMQICQGYDGSI… |
| A0A259M9D4 | 407-523 | None |
| A7BRZ7 | 157-279 | None |
| Q3ASK6 | 70-183 | None |
| A0A0F9A491 | 3-101 | None |
| A0A521QQ93 | 472-596 | None |
| A0A7S4MYP3 | 15-116 | None |
| R9J638 | 296-394 | None |
| A0A7W8MYM8 | 93-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.