DPCstruct | MC28008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 160 ± 47 aa |
| Standard deviation of domain lengths | 47.12 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 85.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.89 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0248- CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2N0Y3 | 14-113 | INSTGEKLTAADLIRNYIMMRRTNDEQETIYKKYWLKLEKIFPESKKLAEFIRFYLATKMYTLTTEKDLYQVFKDYWKALDGENKYL… |
| A0A838HCR9 | 13-235 | LPHQDSRMTQAHQFFSEAMTNWLTTGNSESRAETLTQVLLNGLQLVVIQLEADEDSQEIFETLNARGTPLTAADLIKNFVFQRLDLP… |
| A0A1T4ZHJ8 | 195-332 | None |
| A0A1C6C4E7 | 203-332 | None |
| A0A1I3YWB2 | 21-225 | None |
| A0A844FJC7 | 1-120 | None |
| A0A7Y0IQ99 | 139-283 | None |
| A0A1M5HZN0 | 18-240 | None |
| A0A1I7IAC3 | 202-324 | None |
| W1F8Q1 | 18-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.