DPCstruct | MC28006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 75 ± 10 aa |
| Standard deviation of domain lengths | 10.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 52.66 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | PF14789- CL0536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3VKW6 | 10-67 | NSGCGIPLGDDCVVEAGLYVTAGTKVTGPDGSSVKARELAGQSNLLFRRNSLTGAVEV |
| A0A7W0JCL0 | 16-91 | NAGVGISLGDDCVVAAGCYVTAGSKVTLPDGSVVKARSLSGQSGWQFWLNSVTGRLEAMRRTTAGIELNAALHTNG |
| A0A5Q2VY24 | 267-337 | None |
| A0A3S5JIC8 | 381-452 | None |
| A0A1Q5Q2K3 | 43-98 | None |
| A0A433BG06 | 298-375 | None |
| A0A0A8RB60 | 692-786 | None |
| A0A087BMY2 | 369-449 | None |
| A0A7Y7CSI3 | 1-77 | None |
| A0A6J6R032 | 113-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.