DPCstruct | MC28003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 143 ± 23 aa |
| Standard deviation of domain lengths | 23.18 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.29 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | CL0482- PF05697 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5XS31 | 2-142 | NFEIKNISSTIFEISGSFKEEEIKEVYQRELERLAKSVKIPGFRPGKVPIEIIERKYGEEAKNNAVRSKIADIIEQETKKKDKWIEV… |
| A0A7V2CZ81 | 23-154 | NVEVESLPNCVTSLRVEVPPDRVEGEWARVAADFRAHARVPGFRPGKVPAAVIEKRFEKEIREELTRKLLSETTREVIRERKLRVLS… |
| A0A2E2WUR6 | 2-129 | None |
| T2RDT5 | 3-148 | None |
| A0A2T2UG74 | 5-155 | None |
| A0A7W0PYN9 | 1-155 | None |
| A0A1W9P507 | 24-180 | None |
| W2UZT8 | 60-221 | None |
| A0A1A9VKD8 | 19-172 | None |
| A0A535PDF1 | 7-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.