DPCstruct | MC28002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 101 ± 17 aa |
| Standard deviation of domain lengths | 16.81 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 42.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A352TTZ3 | 57-169 | YIIDMAKESPKLRGNLCYDKQARLERKKFPPASSAMEEAHKIGIQLLDESMYRKLQDIEDFDLKTSSWIATNETLRSLGGALFGDKR… |
| A0A2W5YYJ6 | 4-110 | SAYWLPRFGITSVRAAVITTRHCCNRSLLAHSVDTALKRQCPLPTEQEYFARQKVEEFDTKRSSWVKTPAEIRKLGGALYCDKRYGR… |
| A0A1G4WT36 | 4-78 | None |
| A0A521WNT9 | 185-301 | None |
| A0A0G1G5L8 | 137-256 | None |
| A0A1V5T881 | 26-108 | None |
| A0A1M4NFC7 | 2-87 | None |
| A0A199XP67 | 4-86 | None |
| A0A2M7UR11 | 89-216 | None |
| A0A261QE04 | 221-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.