DPCstruct | MC28
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 237 ± 42 aa |
| Standard deviation of domain lengths | 41.54 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6IIE0 | 1-224 | QLDIDIQKKNYIKGKVKVTEDKQVLFTTIPYEKGWSILVDGKKVDYHSIFDAFIGLDLSVGEHEVEFKFVPPLFKLGLVISLISAIL… |
| A0A6J7PJK5 | 65-322 | PSAATSNAVPSVELRSQSRLLYQADVQGATGPFWLILHESLSDGWHATIKGVDLGAPTMIDGYANGWLVDPTRFGSDFRVKLQWTPQ… |
| A0A7C6TMM1 | 52-293 | None |
| A0A7J0CIS5 | 359-599 | None |
| A0A4P7UCL7 | 513-733 | None |
| A0A6J6QAX6 | 666-901 | None |
| A0A7I7X684 | 2-198 | None |
| A0A498P852 | 256-484 | None |
| A0A6J7LQH9 | 128-372 | None |
| A0A7X9CU37 | 14-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.