DPCstruct | MC27993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Standard deviation of domain lengths | 5.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 60.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8UCS7 | 5-67 | PFQNALLSDICIGTSAAPTYLPAHQFEIKNSTGEVKEFHLIDGGVAANNPTLVAMSEVAKEIN |
| A0A426XPL2 | 2-66 | QAKDDELMNAQLSDICISTSAAPTYLPAHYFKTNNHKGEMREFNLIDGGVAANNPVSKILKAGEK |
| T1NRV5 | 1-68 | None |
| A0A453MGB0 | 6-73 | None |
| A0A834XGD3 | 2-72 | None |
| A0A843UMZ8 | 125-181 | None |
| A0A067KQH2 | 19-79 | None |
| A0A2G2X117 | 53-118 | None |
| A0A1U7XYZ2 | 62-128 | None |
| A0A068UZJ0 | 29-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.