DPCstruct | MC27992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 295 ± 25 aa |
| Standard deviation of domain lengths | 25.47 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 49.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0PBL6 | 234-495 | MVDEKELRVIHYTLGPLKPWDWWTAWLVKPVGVWQDVRQTLEESLPGTGGGRSPHDQLVVKVLFILPVLLLSFGYYQSCFQFSNGMH… |
| A0A426XGP9 | 1-265 | MVDEKELRVIHYTLGPLKPWDWWTAWLLKPVDVWQNVRKQLGDSLPGTGGGRNPNDQLLVKFLFAFPVFLLIFCYYRSFLQINKDLT… |
| M8C767 | 230-546 | None |
| A0A5N5HPV8 | 1-304 | None |
| A0A7R9TGQ5 | 119-456 | None |
| A0A0L9VL11 | 177-480 | None |
| A0A394DCX3 | 598-901 | None |
| A0A5D2XB70 | 125-422 | None |
| A0A5B6X083 | 860-1162 | None |
| A0A7G2F8J2 | 239-490 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.