DPCstruct | MC27991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 102 ± 17 aa |
| Standard deviation of domain lengths | 16.96 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 63.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0114 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452XAX7 | 3-90 | CTDCRRNQPLPPLASPTSSDASPRAPFVVKPPEKKHRLPSAYNRFMREEIQRIKAAKPDIPHREAFSMAAKNWAKCDPRCSSTVSASN |
| A0A426XDU7 | 19-118 | PRDVIQCLCPAGPQMGFQGPCTGLMMEPPSLRSSSSGEQFKKASLITVPKKHRAPSAYNHFMREEIQRIKAAKPDIPHREAFSMAAK… |
| A0A067GY42 | 5-122 | None |
| A0A0H2RHI8 | 1-91 | None |
| A2YMU8 | 28-128 | None |
| A0A2Z6LZL1 | 18-126 | None |
| A0A1R3I6W4 | 37-166 | None |
| V4KXK1 | 79-156 | None |
| A0A059C530 | 116-244 | None |
| A0A061EB61 | 147-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.