DPCstruct | MC2799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 73 ± 4 aa |
| Standard deviation of domain lengths | 4.43 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 55.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A044RUR3 | 5-71 | LKIRLLRAARQIVAEYDLEDSVMTLTIEYPADYPLSVPLIEDEKTIVSRETRRKWLLQLTMFLTHQV |
| A0A0C2GYH3 | 13-79 | LKVRVVPISGEVIAEYTVEETTMRLSIVMPADWPLSVPSIQIDKAIVPSEKVKKWLLQLTAYLFHQV |
| A0A016WBW1 | 2-69 | None |
| A0A2H2IQG5 | 353-422 | None |
| A0A0N4U131 | 76-155 | None |
| Q65XX2 | 1298-1370 | None |
| A0A0N4YWK2 | 338-414 | None |
| A0A2G5VDW0 | 184-255 | None |
| A0A7R9MDP7 | 297-372 | None |
| A0A0N4WZ78 | 138-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.