DPCstruct | MC27989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 156 ± 23 aa |
| Standard deviation of domain lengths | 22.54 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S5U035 | 63-211 | RPAALRPAAPASATPEPRSSGEQMTQATRFFSGGLLADPRSRRAREALPGLAPDERIIQLCNIEALEQVHTANAPLLEPDFLVAYAM… |
| A0A679JZ76 | 1-130 | MRLTRSLVLPLILVGSTQTALADASMDRVLKELEPEERAHQVCNLRGLDAVRKGSHLKGVDRVTTTLQKPAIFKNNVVIAKGGAVRA… |
| J5Q4V4 | 28-197 | None |
| A0A1E5XSV2 | 177-328 | None |
| A0A537LDS9 | 15-146 | None |
| A0A5Q0CAL1 | 223-377 | None |
| A0A346R6G0 | 97-275 | None |
| A0A2S7J182 | 102-260 | None |
| A0A560T8H6 | 14-183 | None |
| A0A440KQ42 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.