DPCstruct | MC27983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 118 ± 17 aa |
| Standard deviation of domain lengths | 17.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7MVP8 | 1-108 | ANVSIKMSGKDKTQILHIDHLCNECGNCQSFCPYDSAPYKEKFTLFQTEEAFDNSKNPGFVLLDRVEHTMKVRVKDEVHRIEGFDPV… |
| A0A7V5TMW5 | 107-220 | FCDKCVEVCPNRANYTYFTAPVDVTLPLLSCREGRLASDGTTRFRIAQTRQIIHVDDFCNQCGNCTTFCVHQGKPYLDKPRLFLREE… |
| A0A2N1QZA0 | 354-494 | None |
| A0A1G3M182 | 60-196 | None |
| A0A496ZR97 | 947-1060 | None |
| A0A522YVY8 | 308-439 | None |
| R6FH17 | 320-446 | None |
| A0A2H6HHV3 | 75-185 | None |
| A0A645F674 | 23-136 | None |
| A0A2X3K1B3 | 328-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.